PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g014770.2
Common NameMTR_2g014770
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family ARF
Protein Properties Length: 614aa    MW: 66762 Da    PI: 6.506
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g014770.2genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B379.73e-25158259199
                      EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                      f+k+lt sd++++g +++p++ ae++      g +++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD v+F   + +
  Medtr2g014770.2 158 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyG-QQRPSQELVAKDLHGSEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFL--RGE 248
                      99*****************************64.4456679************************************************..449 PP

                      EE..EEEEE-S CS
               B3  89 efelvvkvfrk 99 
                      ++el+++++r+
  Medtr2g014770.2 249 DGELRLGIRRA 259
                      999*****996 PP

2Auxin_resp119.72.3e-39284365182
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                      +++a+s++s+F+v+YnPr+s+seF+++v+k++k+l++++s+GmRf+m+feted++err++G+++g+sd+dpvrWp+SkW++L
  Medtr2g014770.2 284 VVNALSKRSAFSVCYNPRVSSSEFIIPVNKFLKSLDCSYSAGMRFRMRFETEDAAERRFTGLIAGISDADPVRWPGSKWKCL 365
                      6899*****************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.22E-42151265IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.0E-40153261IPR015300DNA-binding pseudobarrel domain
CDDcd100172.30E-23156258No hitNo description
PfamPF023623.1E-23158259IPR003340B3 DNA binding domain
SMARTSM010191.1E-23158260IPR003340B3 DNA binding domain
PROSITE profilePS5086313.366158260IPR003340B3 DNA binding domain
PfamPF065071.3E-33285365IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0010582Biological Processfloral meristem determinacy
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 614 aa     Download sequence    Send to blast
MGLIDLNTTE DDETPYSAIS SSSSSSHSGI STSASAAMVV PPPLPPQGSV CLELWHACAG  60
PLISLPKKGS IVVYVPQGHF EQAHDFPVSA CNIPPHVFCR VLDVKLHAEE GSDEVYCQVL  120
LVPENQQLEQ NVREGVIDAD AEEEDTEAIV KSTTPHMFCK TLTASDTSTH GGFSVPRRAA  180
EDCFPPLDYG QQRPSQELVA KDLHGSEWRF RHIYRGQPRR HLLTTGWSAF VNKKKLVSGD  240
AVLFLRGEDG ELRLGIRRAV QLKSSGSFGG LSGMQLDPGS LMDVVNALSK RSAFSVCYNP  300
RVSSSEFIIP VNKFLKSLDC SYSAGMRFRM RFETEDAAER RFTGLIAGIS DADPVRWPGS  360
KWKCLLVRWD DIEASRHNNR VSPWEIEPSG SASNSSNLMA ASLKRTRIGF TSAKLEFPVP  420
NGIGASDFGE SLRFRKVLQG QEILLCPPYG RASFDEARGS GCIGRYDGYP MLGSRNGWPA  480
QMHDAATHLH ASVTSGQVSS PSSVLMFQQA VNPVSNSRYD NINLNQGSYI SEAKSGMFAP  540
SLSDKPILSS GLALEGTTSF GVHDFHNNNN LLDGSRSRDS VLAMRDNQDM VSCKTGCRLF  600
GFSLTDDTHI GGG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1164939518361Auxin response factor 1
4ldw_A1e-1164939518361Auxin response factor 1
4ldw_B1e-1164939518361Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.88400.0leaf| pod| root
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00021PBMTransfer from AT2G33860Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1584970.0AC158497.2 Medicago truncatula chromosome 2 clone mth2-48e18, complete sequence.
GenBankAC2255080.0AC225508.2 Medicago truncatula clone mth2-5b2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013462531.10.0auxin response factor 3
SwissprotO236610.0ARFC_ARATH; Auxin response factor 3
TrEMBLA0A072V4H40.0A0A072V4H4_MEDTR; Auxin response factor
STRINGGLYMA13G30750.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.10.0ARF family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]